PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 1025aa    MW: 116780 Da    PI: 4.801
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001279.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.11.9e-0893137852
                 HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                 +r   NR A r++R++Kka ++ Lee+v  L a+N++L k+l++ 
  Do001279.1  93 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRAQNQQLMKKLQNH 137
                 55666**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.1E-1384154No hitNo description
SMARTSM003381.4E-884153IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.87588135IPR004827Basic-leucine zipper domain
PfamPF077165.0E-1490143IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.06E-793137No hitNo description
CDDcd146861.51E-998145No hitNo description
HamapMF_0050526.451294983IPR001404Heat shock protein Hsp90 family
Gene3DG3DSA:3.30.565.101.1E-92296507IPR003594Histidine kinase-like ATPase, C-terminal domain
PRINTSPR007757.4E-71297317IPR020575Heat shock protein Hsp90, N-terminal
SuperFamilySSF558745.11E-72297505IPR003594Histidine kinase-like ATPase, C-terminal domain
PROSITE patternPS002980317326IPR019805Heat shock protein Hsp90, conserved site
PRINTSPR007757.4E-71318340IPR020575Heat shock protein Hsp90, N-terminal
SMARTSM003871.7E-8319476IPR003594Histidine kinase-like ATPase, C-terminal domain
PfamPF025184.4E-14320475IPR003594Histidine kinase-like ATPase, C-terminal domain
CDDcd000757.95E-10323472No hitNo description
PRINTSPR007757.4E-71369386IPR020575Heat shock protein Hsp90, N-terminal
PRINTSPR007757.4E-71387404IPR020575Heat shock protein Hsp90, N-terminal
PRINTSPR007757.4E-71412434IPR020575Heat shock protein Hsp90, N-terminal
PRINTSPR007757.4E-71464481IPR020575Heat shock protein Hsp90, N-terminal
PfamPF001834.0E-2184781013IPR001404Heat shock protein Hsp90 family
PRINTSPR007757.4E-71482500IPR020575Heat shock protein Hsp90, N-terminal
SuperFamilySSF542117.13E-89561840IPR020568Ribosomal protein S5 domain 2-type fold
SuperFamilySSF1109425.23E-32859982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006457Biological Processprotein folding
GO:0009306Biological Processprotein secretion
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009934Biological Processregulation of meristem structural organization
GO:0010075Biological Processregulation of meristem growth
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0005739Cellular Componentmitochondrion
GO:0005774Cellular Componentvacuolar membrane
GO:0005783Cellular Componentendoplasmic reticulum
GO:0005886Cellular Componentplasma membrane
GO:0009506Cellular Componentplasmodesma
GO:0009507Cellular Componentchloroplast
GO:0048046Cellular Componentapoplast
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005524Molecular FunctionATP binding
GO:0016887Molecular FunctionATPase activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0051082Molecular Functionunfolded protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1025 aa     Download sequence    Send to blast
MDDGDLDFSN PDNFLCPAMG NDPPSSCSMD SYFDDILKDT EHHACTHTHT CNPPVHDNSH  60
THTCVHVHTK IVAASPEAAE TADSPSENNT SKKRPSGNRA AVRKYREKKK AHTASLEEEV  120
VHLRAQNQQL MKKLQNHAAL EAEVARLRCL LVDIRGRIEG EIGAFPYQRP IKNIDLVSSV  180
DQGSFLGGAQ VNNSCDFRCN DQMYCNPGMQ GAMSAQVLGQ GACDIARLLA VFMVSPFQRL  240
LAKKLQVNAE ESSDDLANPP KIEEKLGAVP HGLSTDSEVT QREAESISRK TLRSSAEKFE  300
FQAEVSRLMD IIINSLYSNK DIFLRELISN ASDALDKIRF LSLTDKEVLG EGDTAKLEIQ  360
IKLDKEKKIL SIRDRGIGMT KEDLIKNLGT IAKSGTSAFV EKMQSGGDLN LIGQFGVGFY  420
SVYLVADYVE VVSKHNDDKQ YVWESKADGA FAISEDTWNE PLGRGTEIRL HLRDEAKEYL  480
EEDKLKDLVK KYSEFINFPI YLWSTKEVDV EVPADEEETS EEEESTPETT EEEETEESEE  540
KKPKTKTIKE TTSEWELLND VKAVWLRSPK EVTDEEYSKF YHSLAKDFSD DKPMSWSHFT  600
AEGDVEFKAL LFVPPKAPHD LYESYYNNNK SNLKLYVRRV FISDEFDDLL PKYLNFLKGI  660
VDSDTLPLNV SREMLQQHSS LKTIKKKLIR KALDMIRKIA EEDPDEYSNK DKTDEEKSEM  720
EEKKGQYAKF WNEFGKSIKL GIIEDATNRN RLAKLLRFES TKSDGKLASL DEYISRMKPG  780
QKDIFYITGS SKEQLEKSPF LERLTKKNYE VIFFTDPVDE YLMQYLMDYE DKKFQNVSKE  840
GLKLGKDSKL KDLKESFKEL TDWWKKALES ENVDSVKISN RLHNTPCVVV TSKYGWSANM  900
EKIMQAQTLS DSSKQAYMRG KRVLEINPRH PIIKELRDKV AQDNEGEGLK QTARLVYQTA  960
LMESGFNLPD PKDFASSIYR SVQKSLDLSP DATVEEEDEA EEQPEIEEKE SAKEESEPSY  1020
DKDEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2o1u_A0.029699222665Endoplasmin
2o1u_B0.029699222665Endoplasmin
2o1v_A0.029699222665Endoplasmin
2o1v_B0.029699222665Endoplasmin
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9708710.0EU970871.1 Zea mays clone 352781 endoplasmin precursor, mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966467.10.0PREDICTED: endoplasmin homolog
SwissprotP361830.0ENPL_HORVU; Endoplasmin homolog
TrEMBLA0A0E0E6F40.0A0A0E0E6F4_9ORYZ; Uncharacterized protein
STRINGSi005877m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.12e-62bZIP family protein